Lineage for d4p5oi_ (4p5o I:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898314Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1898322Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1898372Species Human (Homo sapiens), E2 M [TaxId:9606] [143058] (3 PDB entries)
    Uniprot P61081 27-183
    the extra N-terminal peptide, bound to the heterodimeric E1 enzyme for NEDD8, can be seen in the PDB entry 1tt5, chains E and F
  8. 1898376Domain d4p5oi_: 4p5o I: [258095]
    Other proteins in same PDB: d4p5oa1, d4p5oa2, d4p5ob_, d4p5oc1, d4p5oc2, d4p5od_, d4p5oh_, d4p5ok_
    automated match to d2nvuc1
    complexed with zn

Details for d4p5oi_

PDB Entry: 4p5o (more details), 3.11 Å

PDB Description: structure of an rbx1-ubc12~nedd8-cul1-dcn1 complex: a ring-e3- e2~ubiquitin-like protein-substrate intermediate trapped in action
PDB Compounds: (I:) NEDD8-conjugating enzyme Ubc12

SCOPe Domain Sequences for d4p5oi_:

Sequence, based on SEQRES records: (download)

>d4p5oi_ d.20.1.1 (I:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]}
xiklfslkqqkkeeesaggtkgsskkasaaqlriqkdinelnlpktcdisfsdpddllnf
klvicpdegfyksgkfvfsfkvgqgyphdppkvkcetmvyhpsidlegnvslnilredwk
pvltinsiiyglqylflepnpedplnkeaaevlqnnrrlfeqnvqrsmrggyigstyfer
clkh

Sequence, based on observed residues (ATOM records): (download)

>d4p5oi_ d.20.1.1 (I:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]}
xiklfslkqqkkeaaqlriqkdinelnlpktcdisfsdpddllnfklvicpdegfyksgk
fvfsfkvgqgyphdppkvkcetmvyhpsidlegnvslnilredwkpvltinsiiyglqyl
flepnpedplnkeaaevlqnnrrlfeqnvqrsmrggyigstyferclkh

SCOPe Domain Coordinates for d4p5oi_:

Click to download the PDB-style file with coordinates for d4p5oi_.
(The format of our PDB-style files is described here.)

Timeline for d4p5oi_: