Lineage for d4p4kh2 (4p4k H:116-241)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751500Domain d4p4kh2: 4p4k H:116-241 [258090]
    Other proteins in same PDB: d4p4ka1, d4p4ka2, d4p4kc1, d4p4kd1, d4p4ke1, d4p4ke2, d4p4kg1, d4p4kh1
    automated match to d3of6b2
    complexed with 0be, na, nag

Details for d4p4kh2

PDB Entry: 4p4k (more details), 2.8 Å

PDB Description: structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and auto immunity
PDB Compounds: (H:) hTCRav22 beta chain

SCOPe Domain Sequences for d4p4kh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p4kh2 b.1.1.2 (H:116-241) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgr

SCOPe Domain Coordinates for d4p4kh2:

Click to download the PDB-style file with coordinates for d4p4kh2.
(The format of our PDB-style files is described here.)

Timeline for d4p4kh2: