![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.1: Prokaryotic proteases [50495] (11 proteins) |
![]() | Protein Protease A [50500] (1 species) |
![]() | Species Streptomyces griseus, strain k1 [TaxId:1911] [50501] (5 PDB entries) |
![]() | Domain d3sgae_: 3sga E: [25809] complexed with pha |
PDB Entry: 3sga (more details), 1.8 Å
SCOP Domain Sequences for d3sgae_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sgae_ b.47.1.1 (E:) Protease A {Streptomyces griseus, strain k1} iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv l
Timeline for d3sgae_: