Lineage for d3sgae_ (3sga E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60336Family b.47.1.1: Prokaryotic proteases [50495] (9 proteins)
  6. 60394Protein Protease A [50500] (1 species)
  7. 60395Species Streptomyces griseus, strain k1 [TaxId:1911] [50501] (5 PDB entries)
  8. 60397Domain d3sgae_: 3sga E: [25809]

Details for d3sgae_

PDB Entry: 3sga (more details), 1.8 Å

PDB Description: structures of product and inhibitor complexes of streptomyces griseus protease a at 1.8 angstroms resolution. a model for serine protease catalysis

SCOP Domain Sequences for d3sgae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sgae_ b.47.1.1 (E:) Protease A {Streptomyces griseus, strain k1}
iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir
hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg
ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv
l

SCOP Domain Coordinates for d3sgae_:

Click to download the PDB-style file with coordinates for d3sgae_.
(The format of our PDB-style files is described here.)

Timeline for d3sgae_: