Lineage for d4p4kc2 (4p4k C:117-205)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2030187Domain d4p4kc2: 4p4k C:117-205 [258087]
    Other proteins in same PDB: d4p4ka1, d4p4ka2, d4p4kc1, d4p4kd1, d4p4ke1, d4p4ke2, d4p4kg1, d4p4kh1
    automated match to d4eura2
    complexed with 0be, na, nag

Details for d4p4kc2

PDB Entry: 4p4k (more details), 2.8 Å

PDB Description: structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and auto immunity
PDB Compounds: (C:) hTCRav22 alpha chain

SCOPe Domain Sequences for d4p4kc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p4kc2 b.1.1.2 (C:117-205) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d4p4kc2:

Click to download the PDB-style file with coordinates for d4p4kc2.
(The format of our PDB-style files is described here.)

Timeline for d4p4kc2: