Lineage for d4p4kc1 (4p4k C:2-116)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033799Domain d4p4kc1: 4p4k C:2-116 [258086]
    Other proteins in same PDB: d4p4ka1, d4p4kc2, d4p4kd2, d4p4ke1, d4p4kg2, d4p4kh2
    automated match to d4eura1
    complexed with 0be, na, nag

Details for d4p4kc1

PDB Entry: 4p4k (more details), 2.8 Å

PDB Description: structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and auto immunity
PDB Compounds: (C:) hTCRav22 alpha chain

SCOPe Domain Sequences for d4p4kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p4kc1 b.1.1.0 (C:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsvtqmegpvtlseeafltinctytatgypslfwyvqypgeglqlllkatkaddkgsnkg
featyrkettsfhlekgsvqvsdsavyfcalslysgagsyqltfgkgtklsvipn

SCOPe Domain Coordinates for d4p4kc1:

Click to download the PDB-style file with coordinates for d4p4kc1.
(The format of our PDB-style files is described here.)

Timeline for d4p4kc1: