Lineage for d4p4ka1 (4p4k A:2-83)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2545715Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2545716Protein automated matches [226842] (5 species)
    not a true protein
  7. 2545737Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries)
  8. 2545880Domain d4p4ka1: 4p4k A:2-83 [258082]
    Other proteins in same PDB: d4p4ka2, d4p4kc1, d4p4kc2, d4p4kd1, d4p4kd2, d4p4ke2, d4p4kg1, d4p4kg2, d4p4kh1, d4p4kh2
    automated match to d1muja2
    complexed with 0be, na, nag

Details for d4p4ka1

PDB Entry: 4p4k (more details), 2.8 Å

PDB Description: structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and auto immunity
PDB Compounds: (A:) HLA class II histocompatibility antigen, DP alpha 1 chain

SCOPe Domain Sequences for d4p4ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p4ka1 d.19.1.0 (A:2-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggla
niailnnnlntliqrsnhtqat

SCOPe Domain Coordinates for d4p4ka1:

Click to download the PDB-style file with coordinates for d4p4ka1.
(The format of our PDB-style files is described here.)

Timeline for d4p4ka1: