![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
![]() | Protein automated matches [226842] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries) |
![]() | Domain d4p4ka1: 4p4k A:2-83 [258082] Other proteins in same PDB: d4p4ka2, d4p4kc1, d4p4kc2, d4p4kd1, d4p4kd2, d4p4ke2, d4p4kg1, d4p4kg2, d4p4kh1, d4p4kh2 automated match to d1muja2 complexed with 0be, na, nag |
PDB Entry: 4p4k (more details), 2.8 Å
SCOPe Domain Sequences for d4p4ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p4ka1 d.19.1.0 (A:2-83) automated matches {Human (Homo sapiens) [TaxId: 9606]} kadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggla niailnnnlntliqrsnhtqat
Timeline for d4p4ka1: