SCOPe 2.04: Domain d4p2cg_: 4p2c G:

Lineage for d4p2cg_ (4p2c G:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (76 PDB entries)

8. Domain d4p2cg_: 4p2c G: [258081]
   Other proteins in same PDB: d4p2ca_, d4p2cb_, d4p2cc_
   automated match to d3ezjb_

Details for d4p2cg_

PDB Entry: 4p2c, 2.82 Å

PDB Description: complex of shiga toxin 2e with a neutralizing single-domain antibody

PDB Compounds: (G:) Nanobody 1, Anti-F4+ETEC bacteria VHH variable region

SCOPe Domain Sequences for d4p2cg_:

Sequence; same for both SEQRES and ATOM records:

>d4p2cg_ b.1.1.1 (G:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscavsgsifrlstmgwyrqapgkqrefvasitsygdtnyr
dsvkgrftisrdnakntvylqmnslkpedtavyycnanieagtyygpgrdywgqgtqvtv
s

Timeline for d4p2cg_:

• d4p2cg_ is new in SCOPe 2.04-stable
  
• d4p2cg_ appears in SCOPe 2.05
  
• d4p2cg_ appears in the current release, SCOPe 2.08