SCOP 1.63: Domain d2sga__: 2sga -

Lineage for d2sga__ (2sga -)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (11 proteins)

6. Protein Protease A [50500] (1 species)

7. Species Streptomyces griseus, strain k1 [TaxId:1911] [50501] (5 PDB entries)

8. Domain d2sga__: 2sga - [25808]

Details for d2sga__

PDB Entry: 2sga, 1.5 Å

PDB Description: electron density calculations as an extension of protein structure refinement. streptomyces griseus protease at 1.5 angstroms resolution

SCOP Domain Sequences for d2sga__:

Sequence; same for both SEQRES and ATOM records:

>d2sga__ b.47.1.1 (-) Protease A {Streptomyces griseus, strain k1}
iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir
hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg
ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv
l

Timeline for d2sga__:

• d2sga__ first appeared (with stable ids) in SCOP 1.55
  
• d2sga__ appears in SCOP 1.61
  
• d2sga__ appears in SCOP 1.65
  
• d2sga__ appears in the current release, SCOPe 2.08, called d2sgaa_