Lineage for d2sga__ (2sga -)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167857Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 167858Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 167859Family b.47.1.1: Prokaryotic proteases [50495] (11 proteins)
  6. 167920Protein Protease A [50500] (1 species)
  7. 167921Species Streptomyces griseus, strain k1 [TaxId:1911] [50501] (5 PDB entries)
  8. 167922Domain d2sga__: 2sga - [25808]

Details for d2sga__

PDB Entry: 2sga (more details), 1.5 Å

PDB Description: electron density calculations as an extension of protein structure refinement. streptomyces griseus protease at 1.5 angstroms resolution

SCOP Domain Sequences for d2sga__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sga__ b.47.1.1 (-) Protease A {Streptomyces griseus, strain k1}
iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir
hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg
ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv
l

SCOP Domain Coordinates for d2sga__:

Click to download the PDB-style file with coordinates for d2sga__.
(The format of our PDB-style files is described here.)

Timeline for d2sga__: