Lineage for d4p2cc_ (4p2c C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2397831Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2398373Protein automated matches [190381] (11 species)
    not a true protein
  7. 2398413Species Escherichia coli [TaxId:562] [187229] (8 PDB entries)
  8. 2398480Domain d4p2cc_: 4p2c C: [258077]
    Other proteins in same PDB: d4p2ca_, d4p2cg_, d4p2ch_, d4p2ci_, d4p2cj1, d4p2cj2, d4p2ck_
    automated match to d2bosa_

Details for d4p2cc_

PDB Entry: 4p2c (more details), 2.82 Å

PDB Description: complex of shiga toxin 2e with a neutralizing single-domain antibody
PDB Compounds: (C:) Shiga toxin 2e, subunit B

SCOPe Domain Sequences for d4p2cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p2cc_ b.40.2.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs
gfaqvkfn

SCOPe Domain Coordinates for d4p2cc_:

Click to download the PDB-style file with coordinates for d4p2cc_.
(The format of our PDB-style files is described here.)

Timeline for d4p2cc_: