Lineage for d4p2cb_ (4p2c B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788746Protein automated matches [190381] (11 species)
    not a true protein
  7. 2788786Species Escherichia coli [TaxId:562] [187229] (8 PDB entries)
  8. 2788852Domain d4p2cb_: 4p2c B: [258076]
    Other proteins in same PDB: d4p2ca_, d4p2cg_, d4p2ch_, d4p2ci_, d4p2cj1, d4p2cj2, d4p2ck_
    automated match to d2bosa_

Details for d4p2cb_

PDB Entry: 4p2c (more details), 2.82 Å

PDB Description: complex of shiga toxin 2e with a neutralizing single-domain antibody
PDB Compounds: (B:) Shiga toxin 2e, subunit B

SCOPe Domain Sequences for d4p2cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p2cb_ b.40.2.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs
gfaqvkfn

SCOPe Domain Coordinates for d4p2cb_:

Click to download the PDB-style file with coordinates for d4p2cb_.
(The format of our PDB-style files is described here.)

Timeline for d4p2cb_: