Lineage for d4p2ca_ (4p2c A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207715Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2207716Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2208028Family d.165.1.2: Shiga toxin, A-chain [56395] (2 protein domains)
  6. 2208041Protein automated matches [258073] (1 species)
    not a true protein
  7. 2208042Species Escherichia coli [TaxId:562] [258074] (1 PDB entry)
  8. 2208043Domain d4p2ca_: 4p2c A: [258075]
    Other proteins in same PDB: d4p2cb_, d4p2cc_, d4p2cd_, d4p2ce_, d4p2cf_, d4p2cg_, d4p2ch_, d4p2ci_, d4p2cj1, d4p2cj2, d4p2ck_
    automated match to d2ga4a_

Details for d4p2ca_

PDB Entry: 4p2c (more details), 2.82 Å

PDB Description: complex of shiga toxin 2e with a neutralizing single-domain antibody
PDB Compounds: (A:) Shiga toxin 2e, subunit A

SCOPe Domain Sequences for d4p2ca_:

Sequence, based on SEQRES records: (download)

>d4p2ca_ d.165.1.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
qeftidfstqqsyvsslnsirtaistplehisqgatsvsvinhtppgsyisvgirgldvy
qerfdhlrliiernnlsvagfvntttntfyrfsdfahislpgvttismttdssyttpqrv
aalersgmqvsrhslvssylalmefsgntmtreasravlrfvtvtaqalrfrqiqrefrq
alsetapvytmtpedvdltlnwgrisnvlpeyrgeagvrvgrisfnnisailgtvaviln
chhqgarsvravneesqpecqitgdrpvikitntlwesntaaaflnrksqslyttg

Sequence, based on observed residues (ATOM records): (download)

>d4p2ca_ d.165.1.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
qeftidfstqqsyvsslnsirtaistplehisqgatsvsvinhtppgsyisvgirgldvy
qerfdhlrliiernnlsvagfvntttntfyrfsdfahislpgvttismttdssyttpqrv
aalersgmqvsrhslvssylalmefsgntmtreasravlrfvtvtaqalrfrqiqrefrq
alsetapvytmtpedvdltlnwgrisnvlpeyrgeagvrvgrisfnnisailgtvaviln
checqitgdrpvikitntlwesntaaaflnrksqslyttg

SCOPe Domain Coordinates for d4p2ca_:

Click to download the PDB-style file with coordinates for d4p2ca_.
(The format of our PDB-style files is described here.)

Timeline for d4p2ca_: