Lineage for d4prob_ (4pro B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055631Family b.47.1.1: Prokaryotic proteases [50495] (16 protein domains)
  6. 2055637Protein alpha-Lytic protease [50498] (1 species)
  7. 2055638Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (45 PDB entries)
  8. 2055687Domain d4prob_: 4pro B: [25807]
    Other proteins in same PDB: d4proc1, d4proc2, d4prod1, d4prod2

Details for d4prob_

PDB Entry: 4pro (more details), 2.4 Å

PDB Description: alpha-lytic protease complexed with pro region
PDB Compounds: (B:) alpha-lytic protease

SCOPe Domain Sequences for d4prob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4prob_ b.47.1.1 (B:) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

SCOPe Domain Coordinates for d4prob_:

Click to download the PDB-style file with coordinates for d4prob_.
(The format of our PDB-style files is described here.)

Timeline for d4prob_: