Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
Family c.51.4.0: automated matches [191335] (1 protein) not a true family |
Protein automated matches [190179] (8 species) not a true protein |
Species Escherichia coli [TaxId:83333] [257380] (1 PDB entry) |
Domain d4p0eb_: 4p0e B: [258065] automated match to d4hebb_ complexed with po4, so4 |
PDB Entry: 4p0e (more details), 2.3 Å
SCOPe Domain Sequences for d4p0eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p0eb_ c.51.4.0 (B:) automated matches {Escherichia coli [TaxId: 83333]} slylasgsprrqellaqlgvtferivtgieaqrqpqesaqqyvvrlarekaragvaqtak dlpvlgadtivilngevlekprdaehaaqmlrklsgqthqvmtavaladsqhildclvvt dvtfrtltdediagyvasdepldkagaygiqglggcfvrkingsyhavvglplvetyell snfnalre
Timeline for d4p0eb_: