Lineage for d4p0eb_ (4p0e B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882121Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 2882183Family c.51.4.0: automated matches [191335] (1 protein)
    not a true family
  6. 2882184Protein automated matches [190179] (9 species)
    not a true protein
  7. 2882204Species Escherichia coli [TaxId:83333] [257380] (1 PDB entry)
  8. 2882206Domain d4p0eb_: 4p0e B: [258065]
    automated match to d4hebb_
    complexed with po4, so4

Details for d4p0eb_

PDB Entry: 4p0e (more details), 2.3 Å

PDB Description: yhde e33a (p212121 space group)
PDB Compounds: (B:) Maf-like protein YhdE

SCOPe Domain Sequences for d4p0eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p0eb_ c.51.4.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
slylasgsprrqellaqlgvtferivtgieaqrqpqesaqqyvvrlarekaragvaqtak
dlpvlgadtivilngevlekprdaehaaqmlrklsgqthqvmtavaladsqhildclvvt
dvtfrtltdediagyvasdepldkagaygiqglggcfvrkingsyhavvglplvetyell
snfnalre

SCOPe Domain Coordinates for d4p0eb_:

Click to download the PDB-style file with coordinates for d4p0eb_.
(The format of our PDB-style files is described here.)

Timeline for d4p0eb_: