SCOPe 2.08: Domain d4p0va_: 4p0v A:

Lineage for d4p0va_ (4p0v A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein automated matches [190489] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187688] (85 PDB entries)

8. Domain d4p0va_: 4p0v A: [258060]
   automated match to d4demf_
   complexed with 1wo, mg, zol

Details for d4p0va_

PDB Entry: 4p0v, 2.4 Å

PDB Description: crystal structure of human farnesyl diphosphoate synthase in complex with zoledronate and taxodione

PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d4p0va_:

Sequence; same for both SEQRES and ATOM records:

>d4p0va_ a.128.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
ldlpavflqyeedsyshimalieqyaaplppavflglarkiykrrk

Timeline for d4p0va_:

• d4p0va_ first appeared in SCOPe 2.04
  
• d4p0va_ appears in SCOPe 2.07