![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
![]() | Protein automated matches [190059] (14 species) not a true protein |
![]() | Species Pediculus humanus [TaxId:121224] [258056] (2 PDB entries) |
![]() | Domain d4oztu_: 4ozt U: [258058] automated match to d3nsqa_ complexed with neq, p1a |
PDB Entry: 4ozt (more details), 2.7 Å
SCOPe Domain Sequences for d4oztu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oztu_ a.123.1.1 (U:) automated matches {Pediculus humanus [TaxId: 121224]} navanicqatnsqlyqlvewakhiphfsslpiedqvlllragwnelliaafshrsvevrd givlgagitvhrnsahqagvgtifdrvltelvakmrdmnmdrtelgslrsiilfnpevrg lksgqevellrekvyaaleeytrvtrpeepgrfaklllrlpalrsiglkclehlfffkli gdipidtflmdmlgs
Timeline for d4oztu_: