Lineage for d4oznc_ (4ozn C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1907450Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1907708Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 1907709Protein automated matches [190753] (14 species)
    not a true protein
  7. 1907778Species Haloferax mediterranei [TaxId:523841] [258052] (3 PDB entries)
  8. 1907783Domain d4oznc_: 4ozn C: [258054]
    automated match to d2o66a_
    complexed with atp, so4

Details for d4oznc_

PDB Entry: 4ozn (more details), 2.6 Å

PDB Description: GlnK2 from Haloferax mediterranei complexed with ATP
PDB Compounds: (C:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d4oznc_:

Sequence, based on SEQRES records: (download)

>d4oznc_ d.58.5.0 (C:) automated matches {Haloferax mediterranei [TaxId: 523841]}
adlpndggiklvmaiirpdkladvktalaevgapsltvtnvsgrgsqpakksqwrgeeyt
vdlhqkvkvecvvadtpaedvadaiadaahtgekgdgkifilpvenaiqvrtgktgrdav

Sequence, based on observed residues (ATOM records): (download)

>d4oznc_ d.58.5.0 (C:) automated matches {Haloferax mediterranei [TaxId: 523841]}
adlpndggiklvmaiirpdkladvktalaevgapsltvtnvsgrgsqrgeeytvdlhqkv
kvecvvadtpaedvadaiadaahtgekgdgkifilpvenaiqvrtgktgrdav

SCOPe Domain Coordinates for d4oznc_:

Click to download the PDB-style file with coordinates for d4oznc_.
(The format of our PDB-style files is described here.)

Timeline for d4oznc_: