Lineage for d4ozna_ (4ozn A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950865Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2950866Protein automated matches [190753] (21 species)
    not a true protein
  7. 2950988Species Haloferax mediterranei [TaxId:523841] [258052] (3 PDB entries)
  8. 2950991Domain d4ozna_: 4ozn A: [258053]
    automated match to d2o66a_
    complexed with atp, so4

Details for d4ozna_

PDB Entry: 4ozn (more details), 2.6 Å

PDB Description: GlnK2 from Haloferax mediterranei complexed with ATP
PDB Compounds: (A:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d4ozna_:

Sequence, based on SEQRES records: (download)

>d4ozna_ d.58.5.0 (A:) automated matches {Haloferax mediterranei [TaxId: 523841]}
dlpndggiklvmaiirpdkladvktalaevgapsltvtnvsgrgsqpakksqwrgeeytv
dlhqkvkvecvvadtpaedvadaiadaahtgekgdgkifilpvenaiqvrtgktgrdav

Sequence, based on observed residues (ATOM records): (download)

>d4ozna_ d.58.5.0 (A:) automated matches {Haloferax mediterranei [TaxId: 523841]}
dlpndggiklvmaiirpdkladvktalaevgapsltvtnvsgrgsqksqwrgeeytvdlh
qkvkvecvvadtpaedvadaiadaahtgekgdgkifilpvenaiqvrtgktgrdav

SCOPe Domain Coordinates for d4ozna_:

Click to download the PDB-style file with coordinates for d4ozna_.
(The format of our PDB-style files is described here.)

Timeline for d4ozna_: