![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.78: beta-Prism II [51109] (1 superfamily) consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis duplication: consists of two domains of this fold |
![]() | Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) ![]() |
![]() | Family b.78.1.0: automated matches [191418] (1 protein) not a true family |
![]() | Protein automated matches [190587] (5 species) not a true protein |
![]() | Species Mycobacterium smegmatis [TaxId:246196] [258042] (1 PDB entry) |
![]() | Domain d4oitb_: 4oit B: [258043] automated match to d2d04f_ complexed with bma, man |
PDB Entry: 4oit (more details), 2.24 Å
SCOPe Domain Sequences for d4oitb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oitb_ b.78.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} gdtltagqklerggslqsgngaytltlqddgnlvlyardkavwstgtngqdvvraevqtd gnfvlytaekpvwhtdtkgkkevklvlqddrnlvlyakdgpawsleh
Timeline for d4oitb_: