Lineage for d4oiyb_ (4oiy B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010331Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 2010369Family a.118.3.0: automated matches [191673] (1 protein)
    not a true family
  6. 2010370Protein automated matches [191283] (3 species)
    not a true protein
  7. 2010371Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [258040] (1 PDB entry)
  8. 2010373Domain d4oiyb_: 4oiy B: [258041]
    Other proteins in same PDB: d4oiya2
    automated match to d1ku1a_
    complexed with mg

Details for d4oiyb_

PDB Entry: 4oiy (more details), 1.5 Å

PDB Description: Crystal structure of Sec7p catalytic domain
PDB Compounds: (B:) Protein transport protein SEC7

SCOPe Domain Sequences for d4oiyb_:

Sequence, based on SEQRES records: (download)

>d4oiyb_ a.118.3.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
rktalseciaifnnkpkkaipvlikkgflkddspisiakwlletegldmaavgdylgegd
dkniaimhafvdefdftgmsivdalrsflqsfrlpgegqkidrfmlkfaerfvdqnpgvf
skadtayvlsyslimlntdlhssqiknkmslqeflennegidngrdlprdfleglfneia
nnei

Sequence, based on observed residues (ATOM records): (download)

>d4oiyb_ a.118.3.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
rktalseciaifnnkpkkaipvlikkgflkddspisiakwlletegldmaavgdylgegd
dkniaimhafvdefdftgmsivdalrsflqsfrlpgegqkidrfmlkfaerfvdqnpgvf
skadtayvlsyslimlntdlhsknkmslqeflennegidngrdlprdfleglfneianne
i

SCOPe Domain Coordinates for d4oiyb_:

Click to download the PDB-style file with coordinates for d4oiyb_.
(The format of our PDB-style files is described here.)

Timeline for d4oiyb_: