![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.3: Sec7 domain [48425] (2 families) ![]() |
![]() | Family a.118.3.0: automated matches [191673] (1 protein) not a true family |
![]() | Protein automated matches [191283] (3 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [258040] (1 PDB entry) |
![]() | Domain d4oiyb_: 4oiy B: [258041] Other proteins in same PDB: d4oiya2 automated match to d1ku1a_ complexed with mg |
PDB Entry: 4oiy (more details), 1.5 Å
SCOPe Domain Sequences for d4oiyb_:
Sequence, based on SEQRES records: (download)
>d4oiyb_ a.118.3.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} rktalseciaifnnkpkkaipvlikkgflkddspisiakwlletegldmaavgdylgegd dkniaimhafvdefdftgmsivdalrsflqsfrlpgegqkidrfmlkfaerfvdqnpgvf skadtayvlsyslimlntdlhssqiknkmslqeflennegidngrdlprdfleglfneia nnei
>d4oiyb_ a.118.3.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} rktalseciaifnnkpkkaipvlikkgflkddspisiakwlletegldmaavgdylgegd dkniaimhafvdefdftgmsivdalrsflqsfrlpgegqkidrfmlkfaerfvdqnpgvf skadtayvlsyslimlntdlhsknkmslqeflennegidngrdlprdfleglfneianne i
Timeline for d4oiyb_: