Lineage for d4ogyn1 (4ogy N:1-105)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2366398Domain d4ogyn1: 4ogy N:1-105 [258038]
    Other proteins in same PDB: d4ogya_, d4ogyb_, d4ogyl2, d4ogyn2
    automated match to d1dn0a1
    complexed with edo

Details for d4ogyn1

PDB Entry: 4ogy (more details), 2.1 Å

PDB Description: Crystal structure of Fab DX-2930 in complex with human plasma kallikrein at 2.1 Angstrom resolution
PDB Compounds: (N:) dx-2930 light chain

SCOPe Domain Sequences for d4ogyn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ogyn1 b.1.1.0 (N:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspstlsasvgdrvtitcrasqsisswlawyqqkpgkapklliykastlesgvps
rfsgsgsgteftltisslqpddfatyycqqyntywtfgqgtkvei

SCOPe Domain Coordinates for d4ogyn1:

Click to download the PDB-style file with coordinates for d4ogyn1.
(The format of our PDB-style files is described here.)

Timeline for d4ogyn1: