Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d4ogyn1: 4ogy N:1-105 [258038] Other proteins in same PDB: d4ogya_, d4ogyb_, d4ogyl2, d4ogyn2 automated match to d1dn0a1 complexed with edo |
PDB Entry: 4ogy (more details), 2.1 Å
SCOPe Domain Sequences for d4ogyn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ogyn1 b.1.1.0 (N:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspstlsasvgdrvtitcrasqsisswlawyqqkpgkapklliykastlesgvps rfsgsgsgteftltisslqpddfatyycqqyntywtfgqgtkvei
Timeline for d4ogyn1:
View in 3D Domains from other chains: (mouse over for more information) d4ogya_, d4ogyb_, d4ogyl1, d4ogyl2 |