SCOPe 2.08: Domain d4ogyl1: 4ogy L:1-105

Lineage for d4ogyl1 (4ogy L:1-105)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4ogyl1: 4ogy L:1-105 [258036]
   Other proteins in same PDB: d4ogya_, d4ogyb_, d4ogyh_, d4ogyl2, d4ogym_, d4ogyn2
   automated match to d1dn0a1
   complexed with edo

Details for d4ogyl1

PDB Entry: 4ogy, 2.1 Å

PDB Description: Crystal structure of Fab DX-2930 in complex with human plasma kallikrein at 2.1 Angstrom resolution

PDB Compounds: (L:) dx-2930 light chain

SCOPe Domain Sequences for d4ogyl1:

Sequence; same for both SEQRES and ATOM records:

>d4ogyl1 b.1.1.0 (L:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspstlsasvgdrvtitcrasqsisswlawyqqkpgkapklliykastlesgvps
rfsgsgsgteftltisslqpddfatyycqqyntywtfgqgtkvei

Timeline for d4ogyl1:

• d4ogyl1 first appeared in SCOPe 2.04
  
• d4ogyl1 appears in SCOPe 2.07