SCOPe 2.04: Domain d4ogrf2: 4ogr F:151-261

Lineage for d4ogrf2 (4ogr F:151-261)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin T1 [158595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158596] (10 PDB entries)
   Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150

8. Domain d4ogrf2: 4ogr F:151-261 [258035]
   Other proteins in same PDB: d4ogre_
   automated match to d2pk2a1
   complexed with adn, zn

Details for d4ogrf2

PDB Entry: 4ogr, 3 Å

PDB Description: crystal structure of p-tefb complex with aff4 and tat

PDB Compounds: (F:) Cyclin-T1

SCOPe Domain Sequences for d4ogrf2:

Sequence; same for both SEQRES and ATOM records:

>d4ogrf2 a.74.1.1 (F:151-261) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldeltheflqilektpnrlkriwnwrac

Timeline for d4ogrf2:

• d4ogrf2 is new in SCOPe 2.04-stable
  
• d4ogrf2 appears in SCOPe 2.05
  
• d4ogrf2 appears in the current release, SCOPe 2.08