Lineage for d4oefa_ (4oef A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061458Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2061459Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2061695Protein Basic FGF (FGF2) [50355] (1 species)
  7. 2061696Species Human (Homo sapiens) [TaxId:9606] [50356] (19 PDB entries)
  8. 2061703Domain d4oefa_: 4oef A: [258032]
    automated match to d1iila_

Details for d4oefa_

PDB Entry: 4oef (more details), 1.8 Å

PDB Description: crystal structure analysis of fgf2-disaccharide (s6i2) complex
PDB Compounds: (A:) fibroblast growth factor 2

SCOPe Domain Sequences for d4oefa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oefa_ b.42.1.1 (A:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]}
dpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanrylamke
dgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkail
flpms

SCOPe Domain Coordinates for d4oefa_:

Click to download the PDB-style file with coordinates for d4oefa_.
(The format of our PDB-style files is described here.)

Timeline for d4oefa_: