Lineage for d1gbea_ (1gbe A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14825Family b.47.1.1: Prokaryotic proteases [50495] (9 proteins)
  6. 14830Protein alpha-Lytic protease [50498] (1 species)
  7. 14831Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (38 PDB entries)
  8. 14865Domain d1gbea_: 1gbe A: [25803]

Details for d1gbea_

PDB Entry: 1gbe (more details), 2.3 Å

PDB Description: alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by leu

SCOP Domain Sequences for d1gbea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gbea_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrgltqgnacagrgdsggswitsagqaqgvmsglnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

SCOP Domain Coordinates for d1gbea_:

Click to download the PDB-style file with coordinates for d1gbea_.
(The format of our PDB-style files is described here.)

Timeline for d1gbea_: