SCOPe 2.08: Domain d4ocyl2: 4ocy L:113-216

Lineage for d4ocyl2 (4ocy L:113-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4ocyl2: 4ocy L:113-216 [258029]
   Other proteins in same PDB: d4ocyh_, d4ocyl1
   automated match to d2ojzl2

Details for d4ocyl2

PDB Entry: 4ocy, 2.79 Å

PDB Description: fab for methotrexate (unbound apo)

PDB Compounds: (L:) Fab ADD058 Light Chain

SCOPe Domain Sequences for d4ocyl2:

Sequence; same for both SEQRES and ATOM records:

>d4ocyl2 b.1.1.2 (L:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d4ocyl2:

• d4ocyl2 first appeared in SCOPe 2.04
  
• d4ocyl2 appears in SCOPe 2.07