Lineage for d4ocyl1 (4ocy L:1-112)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (19 species)
    not a true protein
  7. 2347951Species Mouse (Mus musculus) [TaxId:10090] [186842] (159 PDB entries)
  8. 2348216Domain d4ocyl1: 4ocy L:1-112 [258028]
    Other proteins in same PDB: d4ocyl2
    automated match to d2ok0l1

Details for d4ocyl1

PDB Entry: 4ocy (more details), 2.79 Å

PDB Description: fab for methotrexate (unbound apo)
PDB Compounds: (L:) Fab ADD058 Light Chain

SCOPe Domain Sequences for d4ocyl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ocyl1 b.1.1.1 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlltqiplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvstrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtqlelk

SCOPe Domain Coordinates for d4ocyl1:

Click to download the PDB-style file with coordinates for d4ocyl1.
(The format of our PDB-style files is described here.)

Timeline for d4ocyl1: