SCOPe 2.05: Domain d4ocfc_: 4ocf C:

Lineage for d4ocfc_ (4ocf C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.13: DsbA-like [100953] (4 proteins)
   contains an all-alpha subdomain insertion

6. Protein automated matches [190208] (8 species)
   not a true protein

7. Species Proteus mirabilis [TaxId:529507] [257245] (3 PDB entries)

8. Domain d4ocfc_: 4ocf C: [258026]
   automated match to d4mcue_
   complexed with scn; mutant

Details for d4ocfc_

PDB Entry: 4ocf, 1.98 Å

PDB Description: crystal structure of the disulfide oxidoreductase dsba (s30xxc33) active site mutant from proteus mirabilis

PDB Compounds: (C:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d4ocfc_:

Sequence; same for both SEQRES and ATOM records:

>d4ocfc_ c.47.1.13 (C:) automated matches {Proteus mirabilis [TaxId: 529507]}
disegkqytnlskpvagapqvveffsfysphcyqfsevykvnstveknvpentkmaryhv
dflgplgkemtrawavaialgvedqvspalfkgiqetqsirsvddirttfinagvkaedy
daainsfvvnslvsqqqnavtdfqingvpamvidgkykmkndgisakspeeyakaysdvv
nqllmkk

Timeline for d4ocfc_:

• d4ocfc_ first appeared in SCOPe 2.04
  
• d4ocfc_ appears in SCOPe 2.06
  
• d4ocfc_ appears in the current release, SCOPe 2.08