| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.13: DsbA-like [100953] (4 proteins) contains an all-alpha subdomain insertion |
| Protein automated matches [190208] (8 species) not a true protein |
| Species Proteus mirabilis [TaxId:529507] [257245] (3 PDB entries) |
| Domain d4ocfc_: 4ocf C: [258026] Other proteins in same PDB: d4ocfa2, d4ocfb2 automated match to d4mcue_ complexed with scn; mutant |
PDB Entry: 4ocf (more details), 1.98 Å
SCOPe Domain Sequences for d4ocfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ocfc_ c.47.1.13 (C:) automated matches {Proteus mirabilis [TaxId: 529507]}
disegkqytnlskpvagapqvveffsfysphcyqfsevykvnstveknvpentkmaryhv
dflgplgkemtrawavaialgvedqvspalfkgiqetqsirsvddirttfinagvkaedy
daainsfvvnslvsqqqnavtdfqingvpamvidgkykmkndgisakspeeyakaysdvv
nqllmkk
Timeline for d4ocfc_: