Lineage for d4nzbo_ (4nzb O:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428807Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2428808Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2428809Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2428810Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 2428811Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (9 PDB entries)
  8. 2428902Domain d4nzbo_: 4nzb O: [258019]
    automated match to d1uv6a_
    complexed with 1pe, act, cl, gol, nag, nse, so4

Details for d4nzbo_

PDB Entry: 4nzb (more details), 2.68 Å

PDB Description: ns9283 bound to ls-achbp
PDB Compounds: (O:) acetylcholine-binding protein

SCOPe Domain Sequences for d4nzbo_:

Sequence, based on SEQRES records: (download)

>d4nzbo_ b.96.1.1 (O:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkk

Sequence, based on observed residues (ATOM records): (download)

>d4nzbo_ b.96.1.1 (O:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtys
ccpeayedvevslnfrkk

SCOPe Domain Coordinates for d4nzbo_:

Click to download the PDB-style file with coordinates for d4nzbo_.
(The format of our PDB-style files is described here.)

Timeline for d4nzbo_: