Class b: All beta proteins [48724] (177 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein Acetylcholine binding protein (ACHBP) [63714] (1 species) |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (8 PDB entries) |
Domain d4nzbj_: 4nzb J: [258013] automated match to d1uv6a_ complexed with 1pe, act, cl, gol, nag, nse, so4 |
PDB Entry: 4nzb (more details), 2.68 Å
SCOPe Domain Sequences for d4nzbj_:
Sequence, based on SEQRES records: (download)
>d4nzbj_ b.96.1.1 (J:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk nsvtysccpeayedvevslnfrkk
>d4nzbj_ b.96.1.1 (J:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtys ccpeayedvevslnfrkk
Timeline for d4nzbj_: