Lineage for d4nzbf_ (4nzb F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1810674Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 1810675Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 1810676Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (8 PDB entries)
  8. 1810753Domain d4nzbf_: 4nzb F: [258005]
    automated match to d1uv6a_
    complexed with 1pe, act, cl, gol, nag, nse, so4

Details for d4nzbf_

PDB Entry: 4nzb (more details), 2.68 Å

PDB Description: ns9283 bound to ls-achbp
PDB Compounds: (F:) acetylcholine-binding protein

SCOPe Domain Sequences for d4nzbf_:

Sequence, based on SEQRES records: (download)

>d4nzbf_ b.96.1.1 (F:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkk

Sequence, based on observed residues (ATOM records): (download)

>d4nzbf_ b.96.1.1 (F:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptddseyfsqysrfeildvtqkknsvt
ysccpeayedvevslnfrkk

SCOPe Domain Coordinates for d4nzbf_:

Click to download the PDB-style file with coordinates for d4nzbf_.
(The format of our PDB-style files is described here.)

Timeline for d4nzbf_: