SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4nxza2 (4nxz A:92-148)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999483Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1999484Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 protein domains)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 1999485Protein DNA polymerase beta [81579] (2 species)
  7. 1999486Species Human (Homo sapiens) [TaxId:9606] [81575] (145 PDB entries)
  8. 1999542Domain d4nxza2: 4nxz A:92-148 [258003]
    Other proteins in same PDB: d4nxza1, d4nxza3
    automated match to d4klia2
    protein/DNA complex; complexed with 1fz, mn, na

Details for d4nxza2

PDB Entry: 4nxz (more details), 2.56 Å

PDB Description: DNA polymerase beta with O6mG in the template base opposite to incoming non-hydrolyzable TTP with manganese in the active site
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d4nxza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nxza2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOPe Domain Coordinates for d4nxza2:

Click to download the PDB-style file with coordinates for d4nxza2.
(The format of our PDB-style files is described here.)

Timeline for d4nxza2: