SCOPe 2.08: Domain d4nsvb_: 4nsv B:

Lineage for d4nsvb_ (4nsv B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein automated matches [190306] (9 species)
   not a true protein

7. Species Lysobacter enzymogenes [TaxId:69] [189631] (4 PDB entries)

8. Domain d4nsvb_: 4nsv B: [257995]
   automated match to d1arba_
   complexed with 2oy, cl, so4; mutant

Details for d4nsvb_

PDB Entry: 4nsv, 0.9 Å

PDB Description: lysobacter enzymogenes lysc endoproteinase k30r mutant covalently inhibited by tlck

PDB Compounds: (B:) Lysyl endopeptidase

SCOPe Domain Sequences for d4nsvb_:

Sequence; same for both SEQRES and ATOM records:

>d4nsvb_ b.47.1.1 (B:) automated matches {Lysobacter enzymogenes [TaxId: 69]}
gvsgscnidvvcpegnghrdvirsvaaysrqgtmwctgslvnnsandkkmyfltanhcgm
ttaaiassmvvywnyqnstcrapgssssgangdgslaqsqtgavvratnaasdftlleln
taanpaynlfwagwdrrdqnfagataihhpnvaekrishstvateisgyngatgtshlhv
fwqasggvtepgssgspiyspekrvlgqlhggpsscsatgadrsdyygrvftswtgggts
atrlsdwldaagtgaqfidgldst

Timeline for d4nsvb_:

• d4nsvb_ first appeared in SCOPe 2.04
  
• d4nsvb_ appears in SCOPe 2.07