SCOPe 2.05: Domain d4nmma_: 4nmm A:

Lineage for d4nmma_ (4nmm A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (27 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (145 PDB entries)

8. Domain d4nmma_: 4nmm A: [257993]
   automated match to d4ldja_
   complexed with mg, y9z

Details for d4nmma_

PDB Entry: 4nmm, 1.89 Å

PDB Description: Crystal Structure of a G12C Oncogenic Variant of Human KRas Bound to a Novel GDP Competitive Covalent Inhibitor

PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d4nmma_:

Sequence; same for both SEQRES and ATOM records:

>d4nmma_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek

Timeline for d4nmma_:

• d4nmma_ first appeared in SCOPe 2.04
  
• d4nmma_ is called d4nmma1 in SCOPe 2.06
  
• d4nmma_ appears in the current release, SCOPe 2.08, called d4nmma1