![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
![]() | Protein automated matches [190081] (33 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [225795] (2 PDB entries) |
![]() | Domain d4nl5b_: 4nl5 B: [257991] automated match to d3hx9a_ complexed with act, cyn, hem |
PDB Entry: 4nl5 (more details), 1.9 Å
SCOPe Domain Sequences for d4nl5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nl5b_ d.58.4.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} pvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesde afqawangpaiaahaghranpvatgasllefevvldvggt
Timeline for d4nl5b_: