Lineage for d4nhjb_ (4nhj B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984691Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1984777Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 1984778Protein automated matches [190858] (17 species)
    not a true protein
  7. 1984805Species Klebsiella pneumoniae [TaxId:573] [255310] (3 PDB entries)
  8. 1984807Domain d4nhjb_: 4nhj B: [257990]
    automated match to d3zq7a_
    protein/DNA complex

Details for d4nhjb_

PDB Entry: 4nhj (more details), 2.7 Å

PDB Description: Crystal structure of Klebsiella pneumoniae RstA DNA-binding domain in complex with RstA box
PDB Compounds: (B:) DNA-binding transcriptional regulator RstA

SCOPe Domain Sequences for d4nhjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nhjb_ a.4.6.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
hktisfgsltidpvnrqvmlggenvalstadfdmlwelathagqimdrdallknlrgvty
dgmdrsvdvaisrlrkklldnatepyriktvrnkgylfaph

SCOPe Domain Coordinates for d4nhjb_:

Click to download the PDB-style file with coordinates for d4nhjb_.
(The format of our PDB-style files is described here.)

Timeline for d4nhjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4nhja_