Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.7: AstE/AspA-like [142526] (3 proteins) Pfam PF04952; Succinylglutamate desuccinylase / Aspartoacylase family; contains extra C-terminal domain, new variant of the Barrel-sandwich hybrid fold (51229) |
Protein automated matches [190870] (2 species) not a true protein |
Species Homo sapiens [TaxId:9606] [257960] (3 PDB entries) |
Domain d4nfra_: 4nfr A: [257988] automated match to d2gu2a1 complexed with as9, zn; mutant |
PDB Entry: 4nfr (more details), 3 Å
SCOPe Domain Sequences for d4nfra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nfra_ c.56.5.7 (A:) automated matches {Homo sapiens [TaxId: 9606]} hiqkvaifggthgneltgvflvkhwlengaeiqrtglevkpfitnpravkkctryidcdl nrifdlenlgkkmsedlpyevrraqeinhlfgpkdsedsydiifdlhnttsnmgctlile dsrnnfliqmfhyiktslaplpcyvyliehpslkyattrsiakypvgievgpqpqgvlra dildqmrkmikhaldfihhfnegkefppcaievykiiekvdyprdengeiaaiihpnlqd qdwkplhpgdpmfltldgktiplggdctvypvfvnaaayyekkeafakttkltlnaksir c
Timeline for d4nfra_: