Lineage for d4nfra_ (4nfr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889922Family c.56.5.7: AstE/AspA-like [142526] (3 proteins)
    Pfam PF04952; Succinylglutamate desuccinylase / Aspartoacylase family; contains extra C-terminal domain, new variant of the Barrel-sandwich hybrid fold (51229)
  6. 2889950Protein automated matches [190870] (2 species)
    not a true protein
  7. 2889951Species Human (Homo sapiens) [TaxId:9606] [257960] (3 PDB entries)
  8. 2889956Domain d4nfra_: 4nfr A: [257988]
    automated match to d2gu2a1
    complexed with as9, zn; mutant

Details for d4nfra_

PDB Entry: 4nfr (more details), 3 Å

PDB Description: human brain aspartoacylase mutant e285a complex with intermediate analog (n-phosphonomethyl-l-aspartate)
PDB Compounds: (A:) Aspartoacylase

SCOPe Domain Sequences for d4nfra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nfra_ c.56.5.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hiqkvaifggthgneltgvflvkhwlengaeiqrtglevkpfitnpravkkctryidcdl
nrifdlenlgkkmsedlpyevrraqeinhlfgpkdsedsydiifdlhnttsnmgctlile
dsrnnfliqmfhyiktslaplpcyvyliehpslkyattrsiakypvgievgpqpqgvlra
dildqmrkmikhaldfihhfnegkefppcaievykiiekvdyprdengeiaaiihpnlqd
qdwkplhpgdpmfltldgktiplggdctvypvfvnaaayyekkeafakttkltlnaksir
c

SCOPe Domain Coordinates for d4nfra_:

Click to download the PDB-style file with coordinates for d4nfra_.
(The format of our PDB-style files is described here.)

Timeline for d4nfra_: