Lineage for d4ndnd2 (4ndn D:126-251)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1669649Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 1669650Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 1669749Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 1669750Protein automated matches [254617] (8 species)
    not a true protein
  7. 1669787Species Human (Homo sapiens) [TaxId:9606] [255522] (2 PDB entries)
  8. 1669795Domain d4ndnd2: 4ndn D:126-251 [257985]
    Other proteins in same PDB: d4ndne_
    automated match to d2obva2
    complexed with edo, mg, ppk, sam

Details for d4ndnd2

PDB Entry: 4ndn (more details), 2.34 Å

PDB Description: structural insights of mat enzymes: mata2b complexed with sam and ppnp
PDB Compounds: (D:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d4ndnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ndnd2 d.130.1.0 (D:126-251) automated matches {Human (Homo sapiens) [TaxId: 9606]}
needigagdqglmfgyatdeteecmpltivlahklnaklaelrrngtlpwlrpdsktqvt
vqymqdrgavlpirvhtivisvqhdeevcldemrdalkekvikavvpakyldedtiyhlq
psgrfv

SCOPe Domain Coordinates for d4ndnd2:

Click to download the PDB-style file with coordinates for d4ndnd2.
(The format of our PDB-style files is described here.)

Timeline for d4ndnd2:

View in 3D
Domains from other chains:
(mouse over for more information)
d4ndne_