SCOPe 2.04: Domain d4ndnd1: 4ndn D:14-125

Lineage for d4ndnd1 (4ndn D:14-125)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255522] (2 PDB entries)

8. Domain d4ndnd1: 4ndn D:14-125 [257984]
   Other proteins in same PDB: d4ndne_
   automated match to d2obva1
   complexed with edo, mg, ppk, sam

Details for d4ndnd1

PDB Entry: 4ndn, 2.34 Å

PDB Description: structural insights of mat enzymes: mata2b complexed with sam and ppnp

PDB Compounds: (D:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d4ndnd1:

Sequence; same for both SEQRES and ATOM records:

>d4ndnd1 d.130.1.0 (D:14-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eegtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetvaktgmillageits
raavdyqkvvreavkhigyddsskgfdyktcnvlvaleqqspdiaqgvhldr

Timeline for d4ndnd1:

• d4ndnd1 is new in SCOPe 2.04-stable
  
• d4ndnd1 appears in SCOPe 2.05
  
• d4ndnd1 appears in the current release, SCOPe 2.08