SCOPe 2.06: Domain d2lpra_: 2lpr A:

Lineage for d2lpra_ (2lpr A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein alpha-Lytic protease [50498] (1 species)

7. Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (45 PDB entries)

8. Domain d2lpra_: 2lpr A: [25798]
   complexed with so4; mutant

Details for d2lpra_

PDB Entry: 2lpr, 2.25 Å

PDB Description: structural basis for broad specificity in alpha-lytic protease mutants

PDB Compounds: (A:) alpha-lytic protease

SCOPe Domain Sequences for d2lpra_:

Sequence; same for both SEQRES and ATOM records:

>d2lpra_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrgltqgnacagrgdsggswitsagqaqgvmsggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

Timeline for d2lpra_:

• d2lpra_ first appeared (with stable ids) in SCOP 1.55
  
• d2lpra_ appears in SCOPe 2.05
  
• d2lpra_ appears in SCOPe 2.07
  
• d2lpra_ appears in the current release, SCOPe 2.08