Lineage for d4n6fb_ (4n6f B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090174Superfamily c.1.31: ThiG-like [110399] (2 families) (S)
    shares the common phosphate-binding site with other superfamilies
  5. 2090187Family c.1.31.0: automated matches [191453] (1 protein)
    not a true family
  6. 2090188Protein automated matches [190693] (2 species)
    not a true protein
  7. 2090189Species Amycolatopsis orientalis [TaxId:797057] [257127] (2 PDB entries)
  8. 2090191Domain d4n6fb_: 4n6f B: [257971]
    automated match to d1tyga_
    complexed with ca, f6r

Details for d4n6fb_

PDB Entry: 4n6f (more details), 2.25 Å

PDB Description: crystal structure of amycolatopsis orientalis bexx complexed with g6p
PDB Compounds: (B:) Putative thiosugar synthase

SCOPe Domain Sequences for d4n6fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n6fb_ c.1.31.0 (B:) automated matches {Amycolatopsis orientalis [TaxId: 797057]}
epwlkigarefrsrilvgieqydsvplvrdvlnaagadvfittvdpdnrrsslllmdlad
elplddftwigttsfartkesalrsarilrdslgieilkldvrgddntpdnagtveaare
lraegmellpfilpdlataraleeagcaalrvmaspvasgrgianpaairelieqigipv
vveggigsarhvaeamelgasatlvntalvraespllmaaamrqaalagllsyesgpmpe
va

SCOPe Domain Coordinates for d4n6fb_:

Click to download the PDB-style file with coordinates for d4n6fb_.
(The format of our PDB-style files is described here.)

Timeline for d4n6fb_: