SCOPe 2.08: Domain d4n3zb_: 4n3z B:

Lineage for d4n3zb_ (4n3z B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.27: G protein-binding domain [103652] (2 families)

5. Family h.1.27.2: Rabaptin-5 [118367] (2 proteins)

6. Protein automated matches [257967] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [257968] (2 PDB entries)

8. Domain d4n3zb_: 4n3z B: [257970]
   automated match to d1x79b_
   complexed with po4

Details for d4n3zb_

PDB Entry: 4n3z, 3.1 Å

PDB Description: crystal structure of rabex-5delta and rabaptin-5c21 complex

PDB Compounds: (B:) Rab GTPase-binding effector protein 1

SCOPe Domain Sequences for d4n3zb_:

Sequence; same for both SEQRES and ATOM records:

>d4n3zb_ h.1.27.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdqvkklqlmlrqandqlektmkdkqeledfikqssedsshqisalvlraqaseillee
lqqglsqakrdvqeqmavlmqs

Timeline for d4n3zb_:

• d4n3zb_ first appeared in SCOPe 2.04
  
• d4n3zb_ appears in SCOPe 2.07