SCOP 1.65: Domain d1boqa_: 1boq A:

Lineage for d1boqa_ (1boq A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (11 proteins)

6. Protein alpha-Lytic protease [50498] (1 species)

7. Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (38 PDB entries)

8. Domain d1boqa_: 1boq A: [25797]
   complexed with so4; mutant

Details for d1boqa_

PDB Entry: 1boq, 2.1 Å

PDB Description: pro region c-terminus: protease active site interactions are critical in catalyzing the folding of alpha-lytic protease

SCOP Domain Sequences for d1boqa_:

Sequence; same for both SEQRES and ATOM records:

>d1boqa_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknit
anyaegavrgltqgnacmgrgdsggswitsagqaqgvmsggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

Timeline for d1boqa_:

• d1boqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1boqa_ appears in SCOP 1.63
  
• d1boqa_ appears in SCOP 1.67
  
• d1boqa_ appears in the current release, SCOPe 2.08