Lineage for d1boqa_ (1boq A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60336Family b.47.1.1: Prokaryotic proteases [50495] (9 proteins)
  6. 60341Protein alpha-Lytic protease [50498] (1 species)
  7. 60342Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (38 PDB entries)
  8. 60371Domain d1boqa_: 1boq A: [25797]

Details for d1boqa_

PDB Entry: 1boq (more details), 2.1 Å

PDB Description: pro region c-terminus: protease active site interactions are critical in catalyzing the folding of alpha-lytic protease

SCOP Domain Sequences for d1boqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1boqa_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknit
anyaegavrgltqgnacmgrgdsggswitsagqaqgvmsggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

SCOP Domain Coordinates for d1boqa_:

Click to download the PDB-style file with coordinates for d1boqa_.
(The format of our PDB-style files is described here.)

Timeline for d1boqa_: