Lineage for d4mz8c_ (4mz8 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2080748Species Campylobacter jejuni [TaxId:192222] [235705] (3 PDB entries)
  8. 2080755Domain d4mz8c_: 4mz8 C: [257966]
    automated match to d4mz1a_
    complexed with 2f2, acy, c91, cl, edo, fmt, gol, imp, so4

Details for d4mz8c_

PDB Entry: 4mz8 (more details), 2.5 Å

PDB Description: crystal structure of the inosine 5'-monophosphate dehydrogenase, with an internal deletion of cbs domain from campylobacter jejuni complexed with inhibitor compound c91
PDB Compounds: (C:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d4mz8c_:

Sequence, based on SEQRES records: (download)

>d4mz8c_ c.1.5.0 (C:) automated matches {Campylobacter jejuni [TaxId: 192222]}
kraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaimmarlg
glgvihknmdiasqvrevkrvkksesggikdlkkrkeypdankdnfgrlrvgaaigvgqm
drvdalveagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakalceag
vdavkvgigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdiakal
avgassvmigsllagtdespgelftyqgrqyksyrgmgslgamqkgssdryfqqgtaqdk
lvpegiegrvpyvgsirsvvhqllgglrssmgyvgakdiedfqkraefveittaglkesh
vhdvtitheapnykv

Sequence, based on observed residues (ATOM records): (download)

>d4mz8c_ c.1.5.0 (C:) automated matches {Campylobacter jejuni [TaxId: 192222]}
kraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaimmarlg
glgvihknmdiasqvrevkrvkkseseypdankdnfgrlrvgaaigvgqmdrvdalveag
vdvvvldsahghskgiidtvkaikakypnldliagniataaaakalceagvdavkvgigp
gsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdiakalavgassvmig
sllagtdespgelftyqgrqyksyrgmgslgamqlvpegiegrvpyvgsirsvvhqllgg
lrssmgyvgakdiedfqkraefveittaglkeshvhdvtitheapnykv

SCOPe Domain Coordinates for d4mz8c_:

Click to download the PDB-style file with coordinates for d4mz8c_.
(The format of our PDB-style files is described here.)

Timeline for d4mz8c_: